| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148219.1 | internal | 184 | 1-552(+) |
Amino Acid sequence : | |||
| ARDEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRV NCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNL | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,550.109 | ||
| Theoretical pI: | 5.945 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 25.972 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.250 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148219.1 | internal | 184 | 1-552(+) |
Amino Acid sequence : | |||
| ARDEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRV NCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNL | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,550.109 | ||
| Theoretical pI: | 5.945 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 25.972 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.250 | ||
| sheet | 0.266 | ||