| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148223.1 | 3prime_partial | 172 | 23-538(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGL | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 17,996.556 | ||
| Theoretical pI: | 7.685 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 30.196 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.267 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148223.1 | 3prime_partial | 172 | 23-538(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGL | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 17,996.556 | ||
| Theoretical pI: | 7.685 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 30.196 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.267 | ||
| sheet | 0.233 | ||