Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148224.1	5prime_partial	222	2-670(+)
Amino Acid sequence :
HEKDFVKRLLNKDYRKRMTASQALSHPWIQDFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVV CSLQYRKLDFEEFAAASISVHQLEGLDTWEQHARRGYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVKLLHGFSSRSMPKISS*
Physicochemical properties
Number of amino acids:		222
Molecular weight:		25,415.256
Theoretical pI:		9.266
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 27055
Instability index:		35.747
aromaticity		0.095
GRAVY		-0.208
Secondary Structure Fraction
Helix		0.333
turn		0.203
sheet		0.275