Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148227.1 | 5prime_partial | 118 | 2-358(+) |
Amino Acid sequence : | |||
REMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQHSGPVRYR* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 11,674.213 | ||
Theoretical pI: | 8.553 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 24.944 | ||
aromaticity | 0.061 | ||
GRAVY | 0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.287 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148227.1 | complete | 115 | 581-234(-) |
Amino Acid sequence : | |||
MITVTIIVSHIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 11,674.213 | ||
Theoretical pI: | 8.553 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 24.944 | ||
aromaticity | 0.061 | ||
GRAVY | 0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.287 | ||
sheet | 0.226 |