Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148236.1 | 5prime_partial | 198 | 3-599(+) |
Amino Acid sequence : | |||
FNRGDDPLVFGTIQCYLQDAKERLVQAVETVEREGISYGFKLVRGAYLTRETELANSLGVSSPIHKCIEATHACYNDCASYMLERLAKGTGSVVLATHNLDSGNAAAAKARELGIGKGNQ KLQFSQLMGMADGLSLGLKNAGFIVSKYLPYGPVDQVIPYLLRRAEENRGLLSASVQDRELIRNELLRRMKTALLGRV* | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 21,706.699 | ||
Theoretical pI: | 8.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12170 | ||
Instability index: | 30.968 | ||
aromaticity | 0.066 | ||
GRAVY | -0.158 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.227 | ||
sheet | 0.318 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148236.1 | 5prime_partial | 198 | 3-599(+) |
Amino Acid sequence : | |||
FNRGDDPLVFGTIQCYLQDAKERLVQAVETVEREGISYGFKLVRGAYLTRETELANSLGVSSPIHKCIEATHACYNDCASYMLERLAKGTGSVVLATHNLDSGNAAAAKARELGIGKGNQ KLQFSQLMGMADGLSLGLKNAGFIVSKYLPYGPVDQVIPYLLRRAEENRGLLSASVQDRELIRNELLRRMKTALLGRV* | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 21,706.699 | ||
Theoretical pI: | 8.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12170 | ||
Instability index: | 30.968 | ||
aromaticity | 0.066 | ||
GRAVY | -0.158 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.227 | ||
sheet | 0.318 |