Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148237.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
HAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQ NLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 14,373.150 | ||
Theoretical pI: | 6.450 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 25.817 | ||
aromaticity | 0.065 | ||
GRAVY | 0.256 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.290 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148237.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
HAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQ NLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 14,373.150 | ||
Theoretical pI: | 6.450 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 25.817 | ||
aromaticity | 0.065 | ||
GRAVY | 0.256 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.290 | ||
sheet | 0.254 |