| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148237.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
| HAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQ NLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,373.150 | ||
| Theoretical pI: | 6.450 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 25.817 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.290 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148237.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
| HAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQ NLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,373.150 | ||
| Theoretical pI: | 6.450 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 25.817 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.290 | ||
| sheet | 0.254 | ||