Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148267.1 | 3prime_partial | 174 | 25-546(+) |
Amino Acid sequence : | |||
MQLNKEAASLDWTKSQSHTLSGRKISDHYEEELISGASSSYTGQKLGGGSKSSSNARASSVAAAYNRFINTSPEKAYPSDEDQLSDASSGTEPYDGDLRGVQENIHAELDPNDVPMIEDD ASSVEIMMDHMGSPYGASISVEDEEPKMGAGKAFVSIVEPDPDNSELGEAIEAF | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 18,568.807 | ||
Theoretical pI: | 4.246 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 54.510 | ||
aromaticity | 0.057 | ||
GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.201 | ||
turn | 0.328 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148267.1 | 3prime_partial | 174 | 25-546(+) |
Amino Acid sequence : | |||
MQLNKEAASLDWTKSQSHTLSGRKISDHYEEELISGASSSYTGQKLGGGSKSSSNARASSVAAAYNRFINTSPEKAYPSDEDQLSDASSGTEPYDGDLRGVQENIHAELDPNDVPMIEDD ASSVEIMMDHMGSPYGASISVEDEEPKMGAGKAFVSIVEPDPDNSELGEAIEAF | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 18,568.807 | ||
Theoretical pI: | 4.246 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 54.510 | ||
aromaticity | 0.057 | ||
GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.201 | ||
turn | 0.328 | ||
sheet | 0.287 |