| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148268.1 | internal | 102 | 2-307(+) |
Amino Acid sequence : | |||
| KSSLDFIVDTASGSHPFDPYMSLLKVHGIMALVGFPSEIKMHPISLIHGARTLSGSTVGGTKDIKEMLEFCAANKVYPEIEVIPIQYVNEALERIVKKDVKY | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,263.024 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 36.331 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.235 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148268.1 | internal | 102 | 2-307(+) |
Amino Acid sequence : | |||
| KSSLDFIVDTASGSHPFDPYMSLLKVHGIMALVGFPSEIKMHPISLIHGARTLSGSTVGGTKDIKEMLEFCAANKVYPEIEVIPIQYVNEALERIVKKDVKY | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,263.024 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 36.331 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.235 | ||
| sheet | 0.245 | ||