Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148302.1 | 5prime_partial | 160 | 3-485(+) |
Amino Acid sequence : | |||
VAFELSERLPLLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKEL AGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 14,838.380 | ||
Theoretical pI: | 10.351 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.428 | ||
aromaticity | 0.015 | ||
GRAVY | -1.193 | ||
Secondary Structure Fraction | |||
Helix | 0.172 | ||
turn | 0.328 | ||
sheet | 0.187 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148302.1 | 5prime_partial | 134 | 2-406(+) |
Amino Acid sequence : | |||
GGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGA CRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,838.380 | ||
Theoretical pI: | 10.351 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.428 | ||
aromaticity | 0.015 | ||
GRAVY | -1.193 | ||
Secondary Structure Fraction | |||
Helix | 0.172 | ||
turn | 0.328 | ||
sheet | 0.187 |