| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148308.1 | internal | 134 | 1-402(+) |
Amino Acid sequence : | |||
| ELSAALRINDLDVTMVYPEPWCMPRLFTAGIAAFYEGYYANKGIKIIKGTVAAGFDSDANGDVKAVKLKDGRVLDADIVVVGVGGRPLTTLFKGQVEEEKGGIKTDAFFKTSVSSVYAVG DVATFPLKLYNELR | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,456.456 | ||
| Theoretical pI: | 5.462 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 23.725 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.209 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148308.1 | internal | 134 | 1-402(+) |
Amino Acid sequence : | |||
| ELSAALRINDLDVTMVYPEPWCMPRLFTAGIAAFYEGYYANKGIKIIKGTVAAGFDSDANGDVKAVKLKDGRVLDADIVVVGVGGRPLTTLFKGQVEEEKGGIKTDAFFKTSVSSVYAVG DVATFPLKLYNELR | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,456.456 | ||
| Theoretical pI: | 5.462 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 23.725 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.209 | ||
| sheet | 0.254 | ||