| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148311.1 | 5prime_partial | 144 | 2-436(+) |
Amino Acid sequence : | |||
| HETVIRIAMNNAPGASGPVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLC FDYELWFKRLFQSKARGVKISDAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,125.400 | ||
| Theoretical pI: | 5.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 38.107 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.167 | ||
| sheet | 0.306 | ||