| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148324.1 | internal | 242 | 1-726(+) |
Amino Acid sequence : | |||
| EEEEMASSPSKTLLNILNPAKRIKTLSPETLIPKSSISTPSPIDGSPSNLTSEQRTRMEVNKSMARWKRNLTLCTARIEKSKAEGMDYLKLEELLVEETWLEALPGELKKPYAKNLCKFV EREIRGSIPIYPPPCLIFNALNSTPFDNVKAIIIGQDPYHGPGQAMGLAFSVPDGVKVPSSLVNIFKELQKDIGCSIPSHGNLERWAIQGVLLLNTVLTVRSHQANSHAKKGWEPFTDAV IR | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 26,857.714 | ||
| Theoretical pI: | 8.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 58.564 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.281 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148324.1 | internal | 242 | 1-726(+) |
Amino Acid sequence : | |||
| EEEEMASSPSKTLLNILNPAKRIKTLSPETLIPKSSISTPSPIDGSPSNLTSEQRTRMEVNKSMARWKRNLTLCTARIEKSKAEGMDYLKLEELLVEETWLEALPGELKKPYAKNLCKFV EREIRGSIPIYPPPCLIFNALNSTPFDNVKAIIIGQDPYHGPGQAMGLAFSVPDGVKVPSSLVNIFKELQKDIGCSIPSHGNLERWAIQGVLLLNTVLTVRSHQANSHAKKGWEPFTDAV IR | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 26,857.714 | ||
| Theoretical pI: | 8.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 58.564 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.281 | ||
| sheet | 0.273 | ||