Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148330.1 | complete | 112 | 174-512(+) |
Amino Acid sequence : | |||
MLPLLTSSSSLMRSRIPCSPGMGNDLIATQKVSLAEALTGYTVQLTTLDGRILTIPINSIINPQYEEVVPWEGMPIPKDPSRKGNLRIKFNIKFPTRLTSEQKAGIKRLLAP* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,346.402 | ||
Theoretical pI: | 9.913 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 44.229 | ||
aromaticity | 0.045 | ||
GRAVY | -0.110 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.295 | ||
sheet | 0.250 |