| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148330.1 | complete | 112 | 174-512(+) |
Amino Acid sequence : | |||
| MLPLLTSSSSLMRSRIPCSPGMGNDLIATQKVSLAEALTGYTVQLTTLDGRILTIPINSIINPQYEEVVPWEGMPIPKDPSRKGNLRIKFNIKFPTRLTSEQKAGIKRLLAP* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,346.402 | ||
| Theoretical pI: | 9.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 44.229 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||