| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148333.1 | internal | 216 | 1-648(+) |
Amino Acid sequence : | |||
| IKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQGQVSVSPCSHIGGHKYAGNVI IFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKIAKGALQETDAADSIANATSSPVGGCC | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 23,597.325 | ||
| Theoretical pI: | 5.178 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 52.253 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.255 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148333.1 | internal | 216 | 1-648(+) |
Amino Acid sequence : | |||
| IKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQGQVSVSPCSHIGGHKYAGNVI IFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKIAKGALQETDAADSIANATSSPVGGCC | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 23,597.325 | ||
| Theoretical pI: | 5.178 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 52.253 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.255 | ||
| sheet | 0.236 | ||