Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148335.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
ARGTKHAARVMIPARGGCIIATSSAASAVAGIAAIGYACSKHAIVGLTKNAAFELGQFGIRVNCVSPGGIATPLAVATTGMTREKFETFIDSMTSLKGVIPKSDDVANAVLYLASDDSRY VSGHDLFVDGILSLGNPVR* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 10,498.345 | ||
Theoretical pI: | 8.656 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 38.922 | ||
aromaticity | 0.061 | ||
GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.242 | ||
sheet | 0.323 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148335.1 | 3prime_partial | 99 | 299-3(-) |
Amino Acid sequence : | |||
MTPLRLVIESMNVSNFSLVIPVVATAKGVAIPPGETQLTRIPNCPSSNAAFFVRPTMACFEHAYPIAAIPATAEAALDVAMMQPPRAGIMTRAACFVPR | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,498.345 | ||
Theoretical pI: | 8.656 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 38.922 | ||
aromaticity | 0.061 | ||
GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.242 | ||
sheet | 0.323 |