Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148339.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
RLPRLLSAALKSRKDQIIKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQGQVS VSPCSHIGGHKYAGNVIIFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKIAKGALQETDAADSIANATSSP | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 25,125.138 | ||
Theoretical pI: | 5.687 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 50.002 | ||
aromaticity | 0.061 | ||
GRAVY | -0.336 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.246 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148339.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
RLPRLLSAALKSRKDQIIKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQGQVS VSPCSHIGGHKYAGNVIIFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKIAKGALQETDAADSIANATSSP | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 25,125.138 | ||
Theoretical pI: | 5.687 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 50.002 | ||
aromaticity | 0.061 | ||
GRAVY | -0.336 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.246 | ||
sheet | 0.250 |