| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148357.1 | internal | 103 | 2-310(+) |
Amino Acid sequence : | |||
| SIGAATSPTRHPCSAHQVMYELRVYSLEEATFGSVLASRAFRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIP | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,403.028 | ||
| Theoretical pI: | 6.935 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 42.362 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.204 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148357.1 | internal | 103 | 2-310(+) |
Amino Acid sequence : | |||
| SIGAATSPTRHPCSAHQVMYELRVYSLEEATFGSVLASRAFRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIP | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,403.028 | ||
| Theoretical pI: | 6.935 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 42.362 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.204 | ||
| sheet | 0.272 | ||