| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148359.1 | 5prime_partial | 164 | 3-497(+) |
Amino Acid sequence : | |||
| HESLLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKAIEEAPKFVKNGDACFVKMIPTKPMVVETF SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTGAKVTKAAAKKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 13,165.257 | ||
| Theoretical pI: | 11.286 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 31.769 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.235 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148359.1 | 5prime_partial | 119 | 544-185(-) |
Amino Acid sequence : | |||
| SKFLTKRKIIMEIRTRHFFLAAALVTLAPVGSFFSTLLITPTATVWRMSLTANRPRGGYSEKVSTTMGLVGIIFTKQASPFFTNFGASSIALPDRLSILVRISENFTAMWEVWQSSTGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,165.257 | ||
| Theoretical pI: | 11.286 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 31.769 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.235 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148359.1 | 5prime_partial | 164 | 3-497(+) |
Amino Acid sequence : | |||
| HESLLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKAIEEAPKFVKNGDACFVKMIPTKPMVVETF SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTGAKVTKAAAKKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 13,165.257 | ||
| Theoretical pI: | 11.286 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 31.769 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.235 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148359.1 | 5prime_partial | 119 | 544-185(-) |
Amino Acid sequence : | |||
| SKFLTKRKIIMEIRTRHFFLAAALVTLAPVGSFFSTLLITPTATVWRMSLTANRPRGGYSEKVSTTMGLVGIIFTKQASPFFTNFGASSIALPDRLSILVRISENFTAMWEVWQSSTGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,165.257 | ||
| Theoretical pI: | 11.286 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 31.769 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.235 | ||
| sheet | 0.252 | ||