| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148362.1 | internal | 101 | 3-305(+) |
Amino Acid sequence : | |||
| VFDPKASLPAKKTLKVKVYMGDGWRMDFKQTHFDAYSPPDFYTRVGIAGVPADSIMKKTRAIEDDWTPVWNEEFDFPLTVPELALLRIEVHEYDMSEKDDF | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,746.218 | ||
| Theoretical pI: | 4.787 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 58.856 | ||
| aromaticity | 0.139 | ||
| GRAVY | -0.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.168 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148362.1 | internal | 101 | 3-305(+) |
Amino Acid sequence : | |||
| VFDPKASLPAKKTLKVKVYMGDGWRMDFKQTHFDAYSPPDFYTRVGIAGVPADSIMKKTRAIEDDWTPVWNEEFDFPLTVPELALLRIEVHEYDMSEKDDF | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,746.218 | ||
| Theoretical pI: | 4.787 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 58.856 | ||
| aromaticity | 0.139 | ||
| GRAVY | -0.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.168 | ||
| sheet | 0.238 | ||