| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148373.1 | internal | 109 | 2-328(+) |
Amino Acid sequence : | |||
| TVFGFRNPEEIPWGETGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSIDAPMFVVGVNEKSYTSDIDVLSNASCTTNCLAPLAKVINDHFGIVEGLMTTVHSITA | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,499.910 | ||
| Theoretical pI: | 4.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 16.660 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.248 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148373.1 | internal | 109 | 2-328(+) |
Amino Acid sequence : | |||
| TVFGFRNPEEIPWGETGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSIDAPMFVVGVNEKSYTSDIDVLSNASCTTNCLAPLAKVINDHFGIVEGLMTTVHSITA | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,499.910 | ||
| Theoretical pI: | 4.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 16.660 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.248 | ||
| sheet | 0.220 | ||