| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148386.1 | 5prime_partial | 106 | 3-323(+) |
Amino Acid sequence : | |||
| IMSSQPEGVMGSIMGAVQNAKDAIVGKPGETKEAEKVGENKGNLSSQAQEMKQKAGETIQEYGKKLTESKETAGHPVEKDSDKGGGIMGSMGNMAGSIKEKFTGPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,016.293 | ||
| Theoretical pI: | 5.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 26.901 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.803 | ||
Secondary Structure Fraction | |||
| Helix | 0.142 | ||
| turn | 0.321 | ||
| sheet | 0.274 | ||