Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148386.1 | 5prime_partial | 106 | 3-323(+) |
Amino Acid sequence : | |||
IMSSQPEGVMGSIMGAVQNAKDAIVGKPGETKEAEKVGENKGNLSSQAQEMKQKAGETIQEYGKKLTESKETAGHPVEKDSDKGGGIMGSMGNMAGSIKEKFTGPT* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,016.293 | ||
Theoretical pI: | 5.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 26.901 | ||
aromaticity | 0.019 | ||
GRAVY | -0.803 | ||
Secondary Structure Fraction | |||
Helix | 0.142 | ||
turn | 0.321 | ||
sheet | 0.274 |