| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148415.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
| GSSTGQAPGEDSEVILYPQAIFKDPFRRGDNILVMCDCYTPAGEPIPTNKRANAAKIFSHPDVAAEVTWYGLEQEYTLLQKDVKWPLGWPIGGFPGPQGPYYCAAGADKAFGRDIVDAHY KACIYAGINISGINGEVMPGQWEFQVGPSVGISA | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,583.501 | ||
| Theoretical pI: | 4.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34170 | ||
| Instability index: | 42.435 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.292 | ||
| sheet | 0.208 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148415.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
| GSSTGQAPGEDSEVILYPQAIFKDPFRRGDNILVMCDCYTPAGEPIPTNKRANAAKIFSHPDVAAEVTWYGLEQEYTLLQKDVKWPLGWPIGGFPGPQGPYYCAAGADKAFGRDIVDAHY KACIYAGINISGINGEVMPGQWEFQVGPSVGISA | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,583.501 | ||
| Theoretical pI: | 4.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34170 | ||
| Instability index: | 42.435 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.292 | ||
| sheet | 0.208 | ||