| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148420.1 | internal | 124 | 3-374(+) |
Amino Acid sequence : | |||
| TSIGAATSPTRHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVG GGLV | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,465.331 | ||
| Theoretical pI: | 6.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 44.605 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.303 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.218 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148420.1 | internal | 124 | 3-374(+) |
Amino Acid sequence : | |||
| TSIGAATSPTRHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVG GGLV | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,465.331 | ||
| Theoretical pI: | 6.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 44.605 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.303 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.218 | ||
| sheet | 0.274 | ||