| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148422.1 | 3prime_partial | 140 | 2-421(+) |
Amino Acid sequence : | |||
| MIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCGTADSICYLYLGRYGN DGWRPDTVTVRKLNSRNSRS | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 11,851.732 | ||
| Theoretical pI: | 8.144 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 38.812 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.216 | ||
| sheet | 0.315 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148422.1 | 5prime_partial | 111 | 421-86(-) |
Amino Acid sequence : | |||
| AAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVVVGFLWRQAASVYLHRVEALPYDLLIILGLWNNG* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,851.732 | ||
| Theoretical pI: | 8.144 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 38.812 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.216 | ||
| sheet | 0.315 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148422.1 | 3prime_partial | 140 | 2-421(+) |
Amino Acid sequence : | |||
| MIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCGTADSICYLYLGRYGN DGWRPDTVTVRKLNSRNSRS | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 11,851.732 | ||
| Theoretical pI: | 8.144 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 38.812 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.216 | ||
| sheet | 0.315 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148422.1 | 5prime_partial | 111 | 421-86(-) |
Amino Acid sequence : | |||
| AAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVVVGFLWRQAASVYLHRVEALPYDLLIILGLWNNG* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,851.732 | ||
| Theoretical pI: | 8.144 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 38.812 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.216 | ||
| sheet | 0.315 | ||