Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148432.1 | 5prime_partial | 122 | 2-370(+) |
Amino Acid sequence : | |||
HEWRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQHSGPVR YR* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 10,210.387 | ||
Theoretical pI: | 8.578 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 24.806 | ||
aromaticity | 0.069 | ||
GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.307 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148432.1 | 5prime_partial | 101 | 551-246(-) |
Amino Acid sequence : | |||
GRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,210.387 | ||
Theoretical pI: | 8.578 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 24.806 | ||
aromaticity | 0.069 | ||
GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.307 | ||
sheet | 0.248 |