Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148433.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
SNSLSLRSFLTKAMAESDVRSEQIHNEEEQEGMSQEQRLKYLDFVHVAAIHSLICLSKLYNFAKENSGPLLPGVQTAEESIKAVVGPVYDKFHNLPFDTLKFVDRKVGESIEEIERHLPS SVKDAAQKAPEVARSISGEVQRAGVVGTATGLARSAYSKAEPTAKVLYSKYEPVAEHYAVSAWRSLNRLPLFPHMA | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,713.331 | ||
Theoretical pI: | 6.384 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 61.839 | ||
aromaticity | 0.077 | ||
GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.235 | ||
sheet | 0.311 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148433.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
SNSLSLRSFLTKAMAESDVRSEQIHNEEEQEGMSQEQRLKYLDFVHVAAIHSLICLSKLYNFAKENSGPLLPGVQTAEESIKAVVGPVYDKFHNLPFDTLKFVDRKVGESIEEIERHLPS SVKDAAQKAPEVARSISGEVQRAGVVGTATGLARSAYSKAEPTAKVLYSKYEPVAEHYAVSAWRSLNRLPLFPHMA | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,713.331 | ||
Theoretical pI: | 6.384 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 61.839 | ||
aromaticity | 0.077 | ||
GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.235 | ||
sheet | 0.311 |