Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148438.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
PPGCRNSARGNAGALLVDGLGDGLLLEAYDKDFDFVRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYV GKTVVKRAIAMEHATEALIQLIKDHGRWVDPSAEE* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 16,673.786 | ||
Theoretical pI: | 5.212 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 30.477 | ||
aromaticity | 0.065 | ||
GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.252 | ||
sheet | 0.271 |