| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148438.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
| PPGCRNSARGNAGALLVDGLGDGLLLEAYDKDFDFVRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYV GKTVVKRAIAMEHATEALIQLIKDHGRWVDPSAEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 16,673.786 | ||
| Theoretical pI: | 5.212 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 30.477 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.252 | ||
| sheet | 0.271 | ||