| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148441.1 | internal | 217 | 2-652(+) |
Amino Acid sequence : | |||
| VPRESLRQTWVPRGSKLKRLEEEKGIVLRFVIGHSATPGGILDRAIDAENAKTKDFLRLDHIEGYHELSTKTRLYFSTALSIWDADFYVKVDDDVHVNLGMLTTTLARHKTKPRIYIGCM KSGPVLYHKGVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLAAYISINAPILHRYANEDVSLGSWLIGLEVQHVDERTMCCGTPPDCEWKAQSGN | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 17,842.713 | ||
| Theoretical pI: | 6.185 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25355 | ||
| Instability index: | 54.868 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.213 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148441.1 | complete | 155 | 526-59(-) |
Amino Acid sequence : | |||
| MQYWCIDGNICSKILRDGINLAGGMSKIFISLLSEFPKLWFMVFYPLMVENWTRLHTTNIDPWLGFMPSKRCGKHTEINMHIIINLDVEIGIPNRQCGRKIQSRLGREFVVAFDVIESQE VLCLCILCIDGAVENTARSSTMADHEPKHDTFLFF* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,842.713 | ||
| Theoretical pI: | 6.185 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25355 | ||
| Instability index: | 54.868 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.213 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148441.1 | internal | 217 | 2-652(+) |
Amino Acid sequence : | |||
| VPRESLRQTWVPRGSKLKRLEEEKGIVLRFVIGHSATPGGILDRAIDAENAKTKDFLRLDHIEGYHELSTKTRLYFSTALSIWDADFYVKVDDDVHVNLGMLTTTLARHKTKPRIYIGCM KSGPVLYHKGVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLAAYISINAPILHRYANEDVSLGSWLIGLEVQHVDERTMCCGTPPDCEWKAQSGN | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 17,842.713 | ||
| Theoretical pI: | 6.185 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25355 | ||
| Instability index: | 54.868 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.213 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148441.1 | complete | 155 | 526-59(-) |
Amino Acid sequence : | |||
| MQYWCIDGNICSKILRDGINLAGGMSKIFISLLSEFPKLWFMVFYPLMVENWTRLHTTNIDPWLGFMPSKRCGKHTEINMHIIINLDVEIGIPNRQCGRKIQSRLGREFVVAFDVIESQE VLCLCILCIDGAVENTARSSTMADHEPKHDTFLFF* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,842.713 | ||
| Theoretical pI: | 6.185 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25355 | ||
| Instability index: | 54.868 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.213 | ||
| sheet | 0.226 | ||