Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148451.1 | 5prime_partial | 144 | 3-437(+) |
Amino Acid sequence : | |||
TQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLAEGQAEHSAESKEDNTPAKEEDTPTG DGDAEAKYVAELKEVVEEDKKTEE* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,694.955 | ||
Theoretical pI: | 4.449 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 46.842 | ||
aromaticity | 0.076 | ||
GRAVY | -0.878 | ||
Secondary Structure Fraction | |||
Helix | 0.194 | ||
turn | 0.208 | ||
sheet | 0.347 |