Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148454.1 | 5prime_partial | 170 | 3-515(+) |
Amino Acid sequence : | |||
TRAGRREVAESCVEAVMTEMVILYGNRLYADKPDLAARRIEAVGFQVGHQLSERYTMERPRFSDHLDAIKFICKDFWSELFKKQIDNLKTNHRGTFVLQDNQFGWAEHLSPNTFSTEAVA DSGAAQVTSMYLYFPCGIIRGALSNLGIPCAVSADISNHPACSFVVRIKA* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,035.493 | ||
Theoretical pI: | 6.895 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 27.672 | ||
aromaticity | 0.100 | ||
GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.206 | ||
sheet | 0.259 |