| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148463.1 | internal | 125 | 1-375(+) |
Amino Acid sequence : | |||
| GCSSGPNTFLVISEIVEAIGDHCRKLGHNPPEIQYILNDLPGNDFNTLFDYSEKFKEKLKEVEEEVVPYVVGVPGSFYGRLFPQSSVHFIHSSYSLHWLSQGLMNEAKVEDFNLPIYAAS MEEVM | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,113.763 | ||
| Theoretical pI: | 4.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 48.094 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.288 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148463.1 | internal | 125 | 1-375(+) |
Amino Acid sequence : | |||
| GCSSGPNTFLVISEIVEAIGDHCRKLGHNPPEIQYILNDLPGNDFNTLFDYSEKFKEKLKEVEEEVVPYVVGVPGSFYGRLFPQSSVHFIHSSYSLHWLSQGLMNEAKVEDFNLPIYAAS MEEVM | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,113.763 | ||
| Theoretical pI: | 4.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 48.094 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.288 | ||
| sheet | 0.248 | ||