| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148481.1 | internal | 193 | 2-580(+) |
Amino Acid sequence : | |||
| HEPWSEYRYYDPRTVGLDFDGMIADIKAAPDGSFILLHGCAHNPTGIDPTPDQWEKIADVIQEKNHVPFFDVAYQGFASGSLDEDASSVRLFVARGMELLVAQSYSKNLGLYAERIGAIN VVCSSPEAATRVKSQLKRLARPMYSNPPIHGAKIVANVVGDPTLFNEWKEEMELMAGRIKNVRQRLFDSLSGK | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,469.112 | ||
| Theoretical pI: | 5.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 29.345 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.249 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148481.1 | internal | 193 | 2-580(+) |
Amino Acid sequence : | |||
| HEPWSEYRYYDPRTVGLDFDGMIADIKAAPDGSFILLHGCAHNPTGIDPTPDQWEKIADVIQEKNHVPFFDVAYQGFASGSLDEDASSVRLFVARGMELLVAQSYSKNLGLYAERIGAIN VVCSSPEAATRVKSQLKRLARPMYSNPPIHGAKIVANVVGDPTLFNEWKEEMELMAGRIKNVRQRLFDSLSGK | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,469.112 | ||
| Theoretical pI: | 5.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 29.345 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.249 | ||
| sheet | 0.259 | ||