| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148499.1 | 5prime_partial | 121 | 2-367(+) |
Amino Acid sequence : | |||
| RWRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQHSGPVRY R* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 11,674.213 | ||
| Theoretical pI: | 8.553 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 24.944 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.287 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148499.1 | complete | 115 | 590-243(-) |
Amino Acid sequence : | |||
| MITVTIIVSHIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 11,674.213 | ||
| Theoretical pI: | 8.553 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 24.944 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.287 | ||
| sheet | 0.226 | ||