| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148503.1 | 3prime_partial | 168 | 42-545(+) |
Amino Acid sequence : | |||
| MAKVNGSDEPAGRTIEIDQKTLYGVLRGFVEGISADAGGGEPLARRIRSSFFRTAPHLREASRNSVHDLLRWTRQGSPLRALLVISVGTITLISLTGLLVFMIFFVAATLNAIIISALLS LAAAGGFLALFFACLTGIYIAALSTAVFVISAITISTIIAVMVATGWI | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 17,766.733 | ||
| Theoretical pI: | 9.994 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 38.735 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.854 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.214 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148503.1 | 3prime_partial | 168 | 42-545(+) |
Amino Acid sequence : | |||
| MAKVNGSDEPAGRTIEIDQKTLYGVLRGFVEGISADAGGGEPLARRIRSSFFRTAPHLREASRNSVHDLLRWTRQGSPLRALLVISVGTITLISLTGLLVFMIFFVAATLNAIIISALLS LAAAGGFLALFFACLTGIYIAALSTAVFVISAITISTIIAVMVATGWI | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 17,766.733 | ||
| Theoretical pI: | 9.994 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 38.735 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.854 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.214 | ||
| sheet | 0.310 | ||