Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148503.1 | 3prime_partial | 168 | 42-545(+) |
Amino Acid sequence : | |||
MAKVNGSDEPAGRTIEIDQKTLYGVLRGFVEGISADAGGGEPLARRIRSSFFRTAPHLREASRNSVHDLLRWTRQGSPLRALLVISVGTITLISLTGLLVFMIFFVAATLNAIIISALLS LAAAGGFLALFFACLTGIYIAALSTAVFVISAITISTIIAVMVATGWI | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 17,766.733 | ||
Theoretical pI: | 9.994 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 38.735 | ||
aromaticity | 0.083 | ||
GRAVY | 0.854 | ||
Secondary Structure Fraction | |||
Helix | 0.393 | ||
turn | 0.214 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148503.1 | 3prime_partial | 168 | 42-545(+) |
Amino Acid sequence : | |||
MAKVNGSDEPAGRTIEIDQKTLYGVLRGFVEGISADAGGGEPLARRIRSSFFRTAPHLREASRNSVHDLLRWTRQGSPLRALLVISVGTITLISLTGLLVFMIFFVAATLNAIIISALLS LAAAGGFLALFFACLTGIYIAALSTAVFVISAITISTIIAVMVATGWI | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 17,766.733 | ||
Theoretical pI: | 9.994 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 38.735 | ||
aromaticity | 0.083 | ||
GRAVY | 0.854 | ||
Secondary Structure Fraction | |||
Helix | 0.393 | ||
turn | 0.214 | ||
sheet | 0.310 |