| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148511.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
| ARAQVGIKVHQGEREMASDNKMLGEFDLAGIPPAPRGMPQIEVTFDIDANGIVKVSAKDKATGREQEITIRSSGGLSDDEIEKMVREAEAHAQKDQERKSLIDLKNTADTTIYSVEKSLG EYREKLPVEVTKEIEEAVSDLRAAMAGDDLEKIKEKMNAANKSVSKIGEYMHKGGGGSSSSGF | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 12,510.870 | ||
| Theoretical pI: | 8.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 51.785 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.591 | ||
Secondary Structure Fraction | |||
| Helix | 0.436 | ||
| turn | 0.209 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148511.1 | 5prime_partial | 110 | 549-217(-) |
Amino Acid sequence : | |||
| EPRRRTASTTFMHILSDLRDRLICCVHLLLDLLQIITSHSSPQIRNGFLNLLCNLDWKLLPIFSQALLNTIYGGICCVLKINQTLPFLILLGVGLCLSYHLLNLIIREPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,510.870 | ||
| Theoretical pI: | 8.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 51.785 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.591 | ||
Secondary Structure Fraction | |||
| Helix | 0.436 | ||
| turn | 0.209 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148511.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
| ARAQVGIKVHQGEREMASDNKMLGEFDLAGIPPAPRGMPQIEVTFDIDANGIVKVSAKDKATGREQEITIRSSGGLSDDEIEKMVREAEAHAQKDQERKSLIDLKNTADTTIYSVEKSLG EYREKLPVEVTKEIEEAVSDLRAAMAGDDLEKIKEKMNAANKSVSKIGEYMHKGGGGSSSSGF | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 12,510.870 | ||
| Theoretical pI: | 8.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 51.785 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.591 | ||
Secondary Structure Fraction | |||
| Helix | 0.436 | ||
| turn | 0.209 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148511.1 | 5prime_partial | 110 | 549-217(-) |
Amino Acid sequence : | |||
| EPRRRTASTTFMHILSDLRDRLICCVHLLLDLLQIITSHSSPQIRNGFLNLLCNLDWKLLPIFSQALLNTIYGGICCVLKINQTLPFLILLGVGLCLSYHLLNLIIREPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,510.870 | ||
| Theoretical pI: | 8.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 51.785 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.591 | ||
Secondary Structure Fraction | |||
| Helix | 0.436 | ||
| turn | 0.209 | ||
| sheet | 0.282 | ||