Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148511.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
ARAQVGIKVHQGEREMASDNKMLGEFDLAGIPPAPRGMPQIEVTFDIDANGIVKVSAKDKATGREQEITIRSSGGLSDDEIEKMVREAEAHAQKDQERKSLIDLKNTADTTIYSVEKSLG EYREKLPVEVTKEIEEAVSDLRAAMAGDDLEKIKEKMNAANKSVSKIGEYMHKGGGGSSSSGF | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 12,510.870 | ||
Theoretical pI: | 8.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 51.785 | ||
aromaticity | 0.064 | ||
GRAVY | 0.591 | ||
Secondary Structure Fraction | |||
Helix | 0.436 | ||
turn | 0.209 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148511.1 | 5prime_partial | 110 | 549-217(-) |
Amino Acid sequence : | |||
EPRRRTASTTFMHILSDLRDRLICCVHLLLDLLQIITSHSSPQIRNGFLNLLCNLDWKLLPIFSQALLNTIYGGICCVLKINQTLPFLILLGVGLCLSYHLLNLIIREPT* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,510.870 | ||
Theoretical pI: | 8.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 51.785 | ||
aromaticity | 0.064 | ||
GRAVY | 0.591 | ||
Secondary Structure Fraction | |||
Helix | 0.436 | ||
turn | 0.209 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148511.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
ARAQVGIKVHQGEREMASDNKMLGEFDLAGIPPAPRGMPQIEVTFDIDANGIVKVSAKDKATGREQEITIRSSGGLSDDEIEKMVREAEAHAQKDQERKSLIDLKNTADTTIYSVEKSLG EYREKLPVEVTKEIEEAVSDLRAAMAGDDLEKIKEKMNAANKSVSKIGEYMHKGGGGSSSSGF | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 12,510.870 | ||
Theoretical pI: | 8.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 51.785 | ||
aromaticity | 0.064 | ||
GRAVY | 0.591 | ||
Secondary Structure Fraction | |||
Helix | 0.436 | ||
turn | 0.209 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148511.1 | 5prime_partial | 110 | 549-217(-) |
Amino Acid sequence : | |||
EPRRRTASTTFMHILSDLRDRLICCVHLLLDLLQIITSHSSPQIRNGFLNLLCNLDWKLLPIFSQALLNTIYGGICCVLKINQTLPFLILLGVGLCLSYHLLNLIIREPT* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,510.870 | ||
Theoretical pI: | 8.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 51.785 | ||
aromaticity | 0.064 | ||
GRAVY | 0.591 | ||
Secondary Structure Fraction | |||
Helix | 0.436 | ||
turn | 0.209 | ||
sheet | 0.282 |