| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148512.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRSNLRTGKPGKLDDGPPPRSPNALGPHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHE PPPELHGVWAHGRLSRVL | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 11,630.869 | ||
| Theoretical pI: | 5.743 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 25.701 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.206 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148512.1 | internal | 137 | 2-412(+) |
Amino Acid sequence : | |||
| PPGCRNSARGAICGPASLVNSMMDLHQGALMLLGPTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMN HLQNSTEFGLMAVSLGY | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 11,630.869 | ||
| Theoretical pI: | 5.743 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 25.701 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.206 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148512.1 | 5prime_partial | 107 | 412-89(-) |
Amino Acid sequence : | |||
| VPERDGHEPKLRGVLEVVHETVRPFLGAHVDAHHASESVPGVGHGFEELVVGVVLEARVDHLEAHLLHAGRVGQRPVAVLFHSEGEVGETLRELERHLGIHGGAQEH* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,630.869 | ||
| Theoretical pI: | 5.743 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 25.701 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.206 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148512.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRSNLRTGKPGKLDDGPPPRSPNALGPHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHE PPPELHGVWAHGRLSRVL | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 11,630.869 | ||
| Theoretical pI: | 5.743 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 25.701 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.206 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148512.1 | internal | 137 | 2-412(+) |
Amino Acid sequence : | |||
| PPGCRNSARGAICGPASLVNSMMDLHQGALMLLGPTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMN HLQNSTEFGLMAVSLGY | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 11,630.869 | ||
| Theoretical pI: | 5.743 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 25.701 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.206 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148512.1 | 5prime_partial | 107 | 412-89(-) |
Amino Acid sequence : | |||
| VPERDGHEPKLRGVLEVVHETVRPFLGAHVDAHHASESVPGVGHGFEELVVGVVLEARVDHLEAHLLHAGRVGQRPVAVLFHSEGEVGETLRELERHLGIHGGAQEH* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,630.869 | ||
| Theoretical pI: | 5.743 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 25.701 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.206 | ||
| sheet | 0.327 | ||