Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148513.1 | complete | 142 | 12-440(+) |
Amino Acid sequence : | |||
MEITPPDTKRWVVFYPIYINSKKTIAEGRRIAAAKSCENPTCFDIGACCEYLKLPCAVEVDKAYPRDFMQRGRVRVLLKRDDRSLSNPAVPSRKQLMVQVAELVPKYQLRTKKPEPVTAS SSVPSKSNSVSSKSGKGGKKKK* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,876.393 | ||
Theoretical pI: | 9.920 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 48.088 | ||
aromaticity | 0.063 | ||
GRAVY | -0.570 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.254 | ||
sheet | 0.197 |