| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148513.1 | complete | 142 | 12-440(+) |
Amino Acid sequence : | |||
| MEITPPDTKRWVVFYPIYINSKKTIAEGRRIAAAKSCENPTCFDIGACCEYLKLPCAVEVDKAYPRDFMQRGRVRVLLKRDDRSLSNPAVPSRKQLMVQVAELVPKYQLRTKKPEPVTAS SSVPSKSNSVSSKSGKGGKKKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,876.393 | ||
| Theoretical pI: | 9.920 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 48.088 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.570 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.254 | ||
| sheet | 0.197 | ||