| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148516.1 | complete | 154 | 60-524(+) |
Amino Acid sequence : | |||
| MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGDM* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 14,248.583 | ||
| Theoretical pI: | 6.175 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 36.457 | ||
| aromaticity | 0.031 | ||
| GRAVY | 0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.411 | ||
| turn | 0.233 | ||
| sheet | 0.318 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148516.1 | complete | 129 | 491-102(-) |
Amino Acid sequence : | |||
| MEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTETEHEVEGGLLLDVVVGKGATIFELLSGKDQTLLVGRDPFLVLDLSLDI VDCVRGFNL* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,248.583 | ||
| Theoretical pI: | 6.175 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 36.457 | ||
| aromaticity | 0.031 | ||
| GRAVY | 0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.411 | ||
| turn | 0.233 | ||
| sheet | 0.318 | ||