Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148516.1 | complete | 154 | 60-524(+) |
Amino Acid sequence : | |||
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGDM* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 14,248.583 | ||
Theoretical pI: | 6.175 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 36.457 | ||
aromaticity | 0.031 | ||
GRAVY | 0.267 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.233 | ||
sheet | 0.318 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148516.1 | complete | 129 | 491-102(-) |
Amino Acid sequence : | |||
MEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTETEHEVEGGLLLDVVVGKGATIFELLSGKDQTLLVGRDPFLVLDLSLDI VDCVRGFNL* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,248.583 | ||
Theoretical pI: | 6.175 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 36.457 | ||
aromaticity | 0.031 | ||
GRAVY | 0.267 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.233 | ||
sheet | 0.318 |