| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148534.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
| FTYPGIDGHPPPGSAPLIDGLSVSLDAGDRCLLVGSNGAGKTTILKILGGKHMVAPEMVRVLGRSAFHDTALTSSGELSYLGGEWRRDVAFAGFEVSIQMDISAEKMIYGVSGIDPQRRD ELIRVLDIDLTWRMHKSSDGQRRRVQICMGLLKPFKVLLLDEI | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,793.383 | ||
| Theoretical pI: | 6.470 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 40.807 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.252 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148534.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
| FTYPGIDGHPPPGSAPLIDGLSVSLDAGDRCLLVGSNGAGKTTILKILGGKHMVAPEMVRVLGRSAFHDTALTSSGELSYLGGEWRRDVAFAGFEVSIQMDISAEKMIYGVSGIDPQRRD ELIRVLDIDLTWRMHKSSDGQRRRVQICMGLLKPFKVLLLDEI | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,793.383 | ||
| Theoretical pI: | 6.470 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 40.807 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.252 | ||
| sheet | 0.252 | ||