| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148535.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| LVSLGNHITCRTTLGKKYYNAGDVDSSLKKIHEETQAMLMGFFIADYIPMLGWLDRLTGMRARLERNFQDFDNFYEHVIDEHIMNSKGREDQDRGAEDFLHTLLNMKKLAGTQLTNEHIK GMLMNIFIGGTYTSSAVVEWIFTELIKKPA | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,234.599 | ||
| Theoretical pI: | 6.066 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 22.017 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.187 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148535.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| LVSLGNHITCRTTLGKKYYNAGDVDSSLKKIHEETQAMLMGFFIADYIPMLGWLDRLTGMRARLERNFQDFDNFYEHVIDEHIMNSKGREDQDRGAEDFLHTLLNMKKLAGTQLTNEHIK GMLMNIFIGGTYTSSAVVEWIFTELIKKPA | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,234.599 | ||
| Theoretical pI: | 6.066 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 22.017 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.187 | ||
| sheet | 0.280 | ||