Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148536.1 | complete | 148 | 98-544(+) |
Amino Acid sequence : | |||
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPFAGGVFLVTIHFPPDYPFKPPKVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV PEIAHMYKTDRAKYESTARSWTQKYAMG* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,521.902 | ||
Theoretical pI: | 7.723 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 46.272 | ||
aromaticity | 0.095 | ||
GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.264 | ||
sheet | 0.216 |