Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148537.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
KQVVKAVATPDPVSNPVVELPLTAENVESVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIQSRLMEKIPEIVAVEPITDEETGLELNKENIEKVLDEIRPYLV GTGGGELEFVAIEEPIVKVRLSGPAAGVMTVRVALTQKLREKIPSIAAVQLL | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 18,463.338 | ||
Theoretical pI: | 4.779 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 47.169 | ||
aromaticity | 0.017 | ||
GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.227 | ||
sheet | 0.326 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148537.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
KQVVKAVATPDPVSNPVVELPLTAENVESVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIQSRLMEKIPEIVAVEPITDEETGLELNKENIEKVLDEIRPYLV GTGGGELEFVAIEEPIVKVRLSGPAAGVMTVRVALTQKLREKIPSIAAVQLL | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 18,463.338 | ||
Theoretical pI: | 4.779 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 47.169 | ||
aromaticity | 0.017 | ||
GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.227 | ||
sheet | 0.326 |