| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148539.1 | internal | 121 | 1-363(+) |
Amino Acid sequence : | |||
| DLVICPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPKELTCAGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKYALLAGT D | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,610.588 | ||
| Theoretical pI: | 7.826 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 40.650 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.215 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148539.1 | internal | 121 | 1-363(+) |
Amino Acid sequence : | |||
| DLVICPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPKELTCAGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKYALLAGT D | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,610.588 | ||
| Theoretical pI: | 7.826 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 40.650 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.215 | ||
| sheet | 0.248 | ||