Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148541.1 | 5prime_partial | 150 | 1-453(+) |
Amino Acid sequence : | |||
LHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAG IFKDDINMDESPGIAIHRKYALHLVAKRYK* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 17,308.972 | ||
Theoretical pI: | 7.915 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 37.495 | ||
aromaticity | 0.107 | ||
GRAVY | -0.191 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.220 | ||
sheet | 0.267 |