Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148551.1 | 5prime_partial | 171 | 2-517(+) |
Amino Acid sequence : | |||
GLQEFGTRNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSST SSELSTQDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 16,089.756 | ||
Theoretical pI: | 9.744 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 63.952 | ||
aromaticity | 0.014 | ||
GRAVY | -1.188 | ||
Secondary Structure Fraction | |||
Helix | 0.166 | ||
turn | 0.310 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148551.1 | 5prime_partial | 145 | 1-438(+) |
Amino Acid sequence : | |||
RAAGIRHEECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQH QQRVEHSGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,089.756 | ||
Theoretical pI: | 9.744 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 63.952 | ||
aromaticity | 0.014 | ||
GRAVY | -1.188 | ||
Secondary Structure Fraction | |||
Helix | 0.166 | ||
turn | 0.310 | ||
sheet | 0.200 |