Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148566.1 | complete | 142 | 53-481(+) |
Amino Acid sequence : | |||
MEITPPDTKRWVVFYPIYINSKKTIAEGRRIAAAKSCENPTCFDIGACCEYLKLPCAVEVDKAYPRDFMQRGRVRVLLKRDDRSLSNPAVPSRKQLMVQVAELVPKYQLRTKKPEPVTAS SSVPSKSNSVSSKSGKGGKKKK* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 12,724.175 | ||
Theoretical pI: | 8.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 68.275 | ||
aromaticity | 0.110 | ||
GRAVY | -0.824 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.257 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148566.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
FSFCCWIWKFVSKESLNDGNNTARYEEMGCVLPNLHKFQEDDRRGPADRRRQVLREPHLLRYRRLLRISEASLCRRGGQGIPSGFYAEREGEGVAEEGRQISFESRGPF* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,724.175 | ||
Theoretical pI: | 8.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 68.275 | ||
aromaticity | 0.110 | ||
GRAVY | -0.824 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.257 | ||
sheet | 0.248 |