Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148571.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
ARAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLAEGQAEHSAESKEDDTPAKEEDTPTGDGDAEAKYVAELKEVVEEDNKTE E* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,265.162 | ||
Theoretical pI: | 4.288 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 45.503 | ||
aromaticity | 0.058 | ||
GRAVY | -1.004 | ||
Secondary Structure Fraction | |||
Helix | 0.182 | ||
turn | 0.182 | ||
sheet | 0.364 |