| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148573.1 | internal | 143 | 3-431(+) |
Amino Acid sequence : | |||
| AVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYKKMSKPGEWGDHVTLQAAA DKFGAKICLLTSFRDTCFVEIVP | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,542.845 | ||
| Theoretical pI: | 9.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 34.994 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.203 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148573.1 | internal | 143 | 3-431(+) |
Amino Acid sequence : | |||
| AVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYKKMSKPGEWGDHVTLQAAA DKFGAKICLLTSFRDTCFVEIVP | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,542.845 | ||
| Theoretical pI: | 9.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 34.994 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.203 | ||
| sheet | 0.203 | ||