Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148580.1	internal	150	1-450(+)
Amino Acid sequence :
AREQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVRASMENGVLTVTVP
Physicochemical properties
Number of amino acids:		150
Molecular weight:		16,175.363
Theoretical pI:		10.400
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5750
Instability index:		44.196
aromaticity		0.081
GRAVY		0.078
Secondary Structure Fraction
Helix		0.302
turn		0.336
sheet		0.221

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148580.1	internal	150	450-1(-)
Amino Acid sequence :
RHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIP EIEGRGGIEHSRTESEWNKRHLDCFDLLSC
Physicochemical properties
Number of amino acids:		150
Molecular weight:		16,175.363
Theoretical pI:		10.400
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5750
Instability index:		44.196
aromaticity		0.081
GRAVY		0.078
Secondary Structure Fraction
Helix		0.302
turn		0.336
sheet		0.221

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148580.1	internal	149	449-3(-)
Amino Acid sequence :
GTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQ RSKDEEGSNTREPNPNGTSDILIVLICSR
Physicochemical properties
Number of amino acids:		149
Molecular weight:		16,175.363
Theoretical pI:		10.400
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5750
Instability index:		44.196
aromaticity		0.081
GRAVY		0.078
Secondary Structure Fraction
Helix		0.302
turn		0.336
sheet		0.221

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148580.1	internal	150	1-450(+)
Amino Acid sequence :
AREQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVRASMENGVLTVTVP
Physicochemical properties
Number of amino acids:		150
Molecular weight:		16,175.363
Theoretical pI:		10.400
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5750
Instability index:		44.196
aromaticity		0.081
GRAVY		0.078
Secondary Structure Fraction
Helix		0.302
turn		0.336
sheet		0.221

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148580.1	internal	150	450-1(-)
Amino Acid sequence :
RHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIP EIEGRGGIEHSRTESEWNKRHLDCFDLLSC
Physicochemical properties
Number of amino acids:		150
Molecular weight:		16,175.363
Theoretical pI:		10.400
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5750
Instability index:		44.196
aromaticity		0.081
GRAVY		0.078
Secondary Structure Fraction
Helix		0.302
turn		0.336
sheet		0.221

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148580.1	internal	149	449-3(-)
Amino Acid sequence :
GTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQ RSKDEEGSNTREPNPNGTSDILIVLICSR
Physicochemical properties
Number of amino acids:		149
Molecular weight:		16,175.363
Theoretical pI:		10.400
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5750
Instability index:		44.196
aromaticity		0.081
GRAVY		0.078
Secondary Structure Fraction
Helix		0.302
turn		0.336
sheet		0.221