| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148589.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
| TSLRMELDIQRFIQNCDQQQFEFPHLPTSYLRCAAHRVAQHYGLQTMGLDNAIDGSGSRVIARKTPESRFPAVCLSDIPTKQHEKENNENIKFVIRPRPSKGSFGDGSESGTRASPIRTV EERKEEYDKARA | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,991.618 | ||
| Theoretical pI: | 8.501 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 53.047 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.855 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.242 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148589.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
| TSLRMELDIQRFIQNCDQQQFEFPHLPTSYLRCAAHRVAQHYGLQTMGLDNAIDGSGSRVIARKTPESRFPAVCLSDIPTKQHEKENNENIKFVIRPRPSKGSFGDGSESGTRASPIRTV EERKEEYDKARA | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,991.618 | ||
| Theoretical pI: | 8.501 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 53.047 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.855 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.242 | ||
| sheet | 0.220 | ||